Recombinant Human PDILT, His-tagged

• Cat.No.: PDILT-171H
• Product Overview: Recombinant Human Protein Disulfide-Isomerase-Like Protein of the Testis/PDILT produced by transfected human cells is a secreted protein with sequence (Ser21-Leu584) of Human PDILT fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 21-584 a.a.
• Description: Protein Disulfide-Isomerase-Like Protein of the Testis (PDILT) is a protein that belongs to the protein disulfide isomerase family. Human PDILT is synthesized as a 584 amino acid precursor that contains an 20 amino acid signal sequence and a 564 amino acid mature chain. PDILT contains 1 thioredoxin domain lacks the conserved redox-active Cys at position 417 which is replaced by a Ser residue, suggesting that it lacks thioredoxin activity. PDILT is an enzyme in the endoplasmic reticulum in eukaryotes. It is not a disulfide-linked homodimer. The PDILT protein can interacts with ERO1L and CLGN. PDILT probable redox-inactive chaperone involved in spermatogenesis.
• Form: Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0
• AA Sequence: SPEVNAGVSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNPSSKQSRNLAEELGKA VEIMGKGKNGIGFGKVDITIEKELQQEFGITKAPELKLFFEGNRSEPISCKGVVESAALVVWLRR QISQKAFLFNSSEQVAEFVISRPLVIVGFFQDLEEEVAELFYDVIKDFPELTFGVITIGNVIGRF HVTLDSVLVFKKGKIVNRQKLINDSTNKQELNRVIKQHLTDFVIEYNTENKDLISELHIMSHMLL FVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDA RYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFV MFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQQAVL YKGEHTLKGFSDFLESHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELEN MTKYVSKLEEPAGKKKTSEEVVVVVAKPKGPPVQKKKPKVKEELVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: PDILT protein disulfide isomerase-like, testis expressed [ Homo sapiens ]
• Official Symbol: PDILT
• Synonyms: PDILT; protein disulfide isomerase-like, testis expressed; protein disulfide-isomerase-like protein of the testis; PDIA7; protein disulfide isomerase family A; member 7; protein disulfide isomerase like protein of the testis; protein disulfide isomerase family A, member 7; protein disulfide isomerase-like protein of the testis
• Gene ID: 204474
• mRNA Refseq: NM_174924
• Protein Refseq: NP_777584
• UniProt ID: Q8N807
• Chromosome Location: 16p12.3
• Function: isomerase activity