Recombinant Human PDIA6, His-tagged

• Cat.No.: PDIA6-124H
• Product Overview: Recombinant Human Protein Disulfide-Isomerase A6/PDIA6 produced by transfected human cells is a secreted protein with sequence (Leu20-Leu440) of human PDIA6 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 20-440 a.a.
• Description: Protein disulfide isomerases (EC 5.3.4.1), such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins
• Form: Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0
• AA Sequence: LYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDAD KHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSG KQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGK VKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSD
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at< -20°c,="" stable="" for="" 6="" months="" after="" receipt.="" please="" minimize="" freeze-thaw="">

Gene Information

• Gene Name: PDIA6 protein disulfide isomerase family A, member 6 [ Homo sapiens(human) ]
• Official Symbol: PDIA6
• Synonyms: PDIA6; P5; ERP5; TXNDC7; protein disulfide isomerase family A, member 6; protein disulfide-isomerase A6; ER protein 5; protein disulfide isomerase P5; endoplasmic reticulum protein 5; thioredoxin domain-containing protein 7; protein disulfide isomerase-associated 6; protein disulfide isomerase-related protein; thioredoxin domain containing 7 (protein disulfide isomerase); EC 5.3.4.1
• Gene ID: 10130
• mRNA Refseq: NM_005742
• Protein Refseq: NP_005733
• MIM: 611099
• UniProt ID: Q15084
• Chromosome Location: 2p25.1
• Pathway: Activation of Chaperone Genes by XBP1(S); Activation of Chaperones by IRE1alpha; Protein processing in endoplasmic reticulum
• Function: electron carrier activity; protein binding; protein disulfide isomerase activity