Recombinant Human PDGFC Protein, His tagged

• Cat.No.: PDGFC-001H
• Product Overview: Recombinant Human PDGFC protein (230-345 aa) with His tag was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. Alternatively spliced transcript variants have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 230-345 aa
• Molecular Mass: 14 kDa
• AA Sequence: MGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGGHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 0.1 % SKL
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: PDGFC platelet derived growth factor C [ Homo sapiens (human) ]
• Official Symbol: PDGFC
• Synonyms: PDGFC; platelet derived growth factor C; platelet-derived growth factor C; fallotein; SCDGF; PDGF-C; VEGF-E; spinal cord-derived growth factor; secretory growth factor-like protein; FALLOTEIN
• Gene ID: 56034
• mRNA Refseq: NM_016205
• Protein Refseq: NP_057289
• MIM: 608452
• UniProt ID: Q9NRA1