Recombinant Human PDGFB protein, GST-tagged

• Cat.No.: PDGFB-301367H
• Product Overview: Recombinant Human PDGFB (136-190 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Asn36-Thr190
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: NRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens ]
• Official Symbol: PDGFB
• Synonyms: PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog) , SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858
• Gene ID: 5155
• mRNA Refseq: NM_002608
• Protein Refseq: NP_002599
• MIM: 190040
• UniProt ID: P01127