Recombinant Human PDE8A

• Cat.No.: PDE8A-30226TH
• Product Overview: Recombinant fragment, corresponding to amino acids 32-121 of Human PDE8A, with an N-terminal proprietary tag, predicted MWt 35.53 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE8 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 35.530kDa inclusive of tags
• Tissue specificity: Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
• Sequence Similarities: Belongs to the cyclic nucleotide phosphodiesterase family. PDE8 subfamily.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 1 PAS (PER-ARNT-SIM) domain.

Gene Information

• Gene Name: PDE8A phosphodiesterase 8A [ Homo sapiens ]
• Official Symbol: PDE8A
• Synonyms: PDE8A; phosphodiesterase 8A; high affinity cAMP-specific and IBMX-insensitive 3,5-cyclic phosphodiesterase 8A; HsT19550
• Gene ID: 5151
• mRNA Refseq: NM_001243137
• Protein Refseq: NP_001230066
• MIM: 602972
• Uniprot ID: O60658
• Chromosome Location: 15q25.3
• Pathway: G Protein Signaling Pathways, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem
• Function: 3,5-cyclic-AMP phosphodiesterase activity; 3,5-cyclic-nucleotide phosphodiesterase activity; hydrolase activity; metal ion binding; phosphoric diester hydrolase activity