Recombinant Human PDE7A protein, His-tagged
Cat.No. : | PDE7A-2928H |
Product Overview : | Recombinant Human PDE7A protein(1-55 aa), fused to His tag, was expressed in E. coli. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-55 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MGITLIWCLALVLIKWITSKRRGAISYDSSDQTALYIRMLGDVRVRSRAGFESER |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDE7A phosphodiesterase 7A [ Homo sapiens ] |
Official Symbol | PDE7A |
Synonyms | PDE7A; phosphodiesterase 7A; high affinity cAMP-specific 3,5-cyclic phosphodiesterase 7A; HCP1; TM22; phosphodiesterase isozyme 7; PDE7; |
Gene ID | 5150 |
mRNA Refseq | NM_001242318 |
Protein Refseq | NP_001229247 |
MIM | 171885 |
UniProt ID | Q13946 |
◆ Recombinant Proteins | ||
PDE7A-12562M | Recombinant Mouse PDE7A Protein | +Inquiry |
PDE7A-1606H | Recombinant Human PDE7A, GST-tagged | +Inquiry |
PDE7A-3820H | Recombinant Human PDE7A Protein, His (Fc)-Avi-tagged | +Inquiry |
PDE7A-481H | Recombinant Human Phosphodiesterase 7A, GST-tagged, Active | +Inquiry |
PDE7A28054H | Recombinant Human PDE7A (130-482) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE7A-3341HCL | Recombinant Human PDE7A 293 Cell Lysate | +Inquiry |
PDE7A-3342HCL | Recombinant Human PDE7A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDE7A Products
Required fields are marked with *
My Review for All PDE7A Products
Required fields are marked with *
0
Inquiry Basket