Recombinant Human PDE6G Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PDE6G-1219H
Product Overview : PDE6G MS Standard C13 and N15-labeled recombinant protein (NP_002593) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. This gene is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. It is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants.
Molecular Mass : 9.6 kDa
AA Sequence : MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGIITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PDE6G phosphodiesterase 6G [ Homo sapiens (human) ]
Official Symbol PDE6G
Synonyms PDE6G; phosphodiesterase 6G, cGMP-specific, rod, gamma; PDEG; retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma; rod cG-PDE G; GMP-PDE gamma; RP57; MGC125749; DKFZp686C0587;
Gene ID 5148
mRNA Refseq NM_002602
Protein Refseq NP_002593
MIM 180073
UniProt ID P18545

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PDE6G Products

Required fields are marked with *

My Review for All PDE6G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon