Recombinant Human PDE6G Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PDE6G-1219H |
Product Overview : | PDE6G MS Standard C13 and N15-labeled recombinant protein (NP_002593) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. This gene is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. It is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 9.6 kDa |
AA Sequence : | MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGIITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PDE6G phosphodiesterase 6G [ Homo sapiens (human) ] |
Official Symbol | PDE6G |
Synonyms | PDE6G; phosphodiesterase 6G, cGMP-specific, rod, gamma; PDEG; retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma; rod cG-PDE G; GMP-PDE gamma; RP57; MGC125749; DKFZp686C0587; |
Gene ID | 5148 |
mRNA Refseq | NM_002602 |
Protein Refseq | NP_002593 |
MIM | 180073 |
UniProt ID | P18545 |
◆ Recombinant Proteins | ||
PDE6G-1219H | Recombinant Human PDE6G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDE6G-353H | Recombinant Human PDE6G | +Inquiry |
Pde6g-4750M | Recombinant Mouse Pde6g Protein, Myc/DDK-tagged | +Inquiry |
PDE6G-8036Z | Recombinant Zebrafish PDE6G | +Inquiry |
PDE6G-6015C | Recombinant Chicken PDE6G | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE6G-3344HCL | Recombinant Human PDE6G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDE6G Products
Required fields are marked with *
My Review for All PDE6G Products
Required fields are marked with *
0
Inquiry Basket