Recombinant Human PDE6G Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PDE6G-1219H
• Product Overview: PDE6G MS Standard C13 and N15-labeled recombinant protein (NP_002593) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. This gene is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. It is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 9.6 kDa
• AA Sequence: MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGIITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PDE6G phosphodiesterase 6G [ Homo sapiens (human) ]
• Official Symbol: PDE6G
• Synonyms: PDE6G; phosphodiesterase 6G, cGMP-specific, rod, gamma; PDEG; retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma; rod cG-PDE G; GMP-PDE gamma; RP57; MGC125749; DKFZp686C0587
• Gene ID: 5148
• mRNA Refseq: NM_002602
• Protein Refseq: NP_002593
• MIM: 180073
• UniProt ID: P18545