Recombinant Human PDE6B protein, GST-tagged

• Cat.No.: PDE6B-3296H
• Product Overview: Recombinant Human PDE6B protein(198-428 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 198-428 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• AA Sequence: GPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWSVLMGESQPYSGPRTPDGREIVFYKVIDYILHGKEEIKVIPTPSADHWALASGLPSYVAESGFICNIMNASADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMESLTQFLGWS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: PDE6B
• Synonyms: PDE6B; phosphodiesterase 6B, cGMP-specific, rod, beta; PDEB; rod cGMP-specific 3,5-cyclic phosphodiesterase subunit beta; congenital stationary night blindness 3; autosomal dominant; CSNB3; rd1; RP40; GMP-PDE beta; rod cGMP-phosphodiesterase beta-subunit; CSNBAD2
• Gene ID: 5158
• mRNA Refseq: NM_000283
• Protein Refseq: NP_000274
• MIM: 180072
• UniProt ID: P35913