Recombinant Human PDE6A protein, GST-tagged

• Cat.No.: PDE6A-1879H
• Product Overview: Recombinant Human PDE6A protein(1-90 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-90 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVMKKLCFLLQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PDE6A phosphodiesterase 6A, cGMP-specific, rod, alpha [ Homo sapiens ]
• Official Symbol: PDE6A
• Synonyms: PDE6A; phosphodiesterase 6A, cGMP-specific, rod, alpha; PDEA; rod cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha; PDE V-B1; GMP-PDE alpha; cGMP phosphodiesterase alpha subunit; rod photoreceptor cGMP phosphodiesterase alpha subunit; RP43; CGPR-A
• Gene ID: 5145
• mRNA Refseq: NM_000440
• Protein Refseq: NP_000431
• MIM: 180071
• UniProt ID: P16499