Recombinant Human PDCD6IP protein(402-652aa), His-tagged

• Cat.No.: PDCD6IP-2793H
• Product Overview: Recombinant Human PDCD6IP protein(Q8WUM4)(402-652aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 402-652aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.3 kDa
• AASequence: PAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PDCD6IP programmed cell death 6 interacting protein [ Homo sapiens ]
• Official Symbol: PDCD6IP
• Synonyms: PDCD6IP; programmed cell death 6 interacting protein; programmed cell death 6-interacting protein; AIP1; ALG 2 interacting protein X; Alix; Hp95; PDCD6-interacting protein; ALG-2 interacting protein 1; dopamine receptor interacting protein 4; apoptosis-linked gene 2-interacting protein X; ALIX; HP95; DRIP4; MGC17003
• Gene ID: 10015
• mRNA Refseq: NM_001162429
• Protein Refseq: NP_001155901
• MIM: 608074
• UniProt ID: Q8WUM4