Recombinant Human PDCD6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PDCD6-2556H
• Product Overview: PDCD6 MS Standard C13 and N15-labeled recombinant protein (NP_037364) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5.
• Molecular Mass: 21.9 kDa
• AA Sequence: MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PDCD6 programmed cell death 6 [ Homo sapiens (human) ]
• Official Symbol: PDCD6
• Synonyms: PDCD6; programmed cell death 6; programmed cell death protein 6; ALG 2; apoptosis linked gene 2; PEF1B; apoptosis-linked gene-2; apoptosis-linked gene 2 protein; probable calcium-binding protein ALG-2; ALG-2; MGC9123; FLJ46208; MGC111017; MGC119050
• Gene ID: 10016
• mRNA Refseq: NM_013232
• Protein Refseq: NP_037364
• MIM: 601057
• UniProt ID: O75340