Recombinant Human PDCD2L Protein, GST-tagged

Cat.No. : PDCD2L-4355H
Product Overview : Human MGC13096 full-length ORF ( NP_115722.1, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : PDCD2L (Programmed Cell Death 2 Like) is a Protein Coding gene. An important paralog of this gene is ENSG00000266953.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 65.8 kDa
AA Sequence : MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PDCD2L programmed cell death 2-like [ Homo sapiens ]
Official Symbol PDCD2L
Synonyms PDCD2L; programmed cell death 2-like; programmed cell death protein 2-like; MGC13096;
Gene ID 84306
mRNA Refseq NM_032346
Protein Refseq NP_115722
UniProt ID Q9BRP1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PDCD2L Products

Required fields are marked with *

My Review for All PDCD2L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon