Recombinant Human PDAP1, His-tagged

• Cat.No.: PDAP1-29488TH
• Product Overview: Recombinant full length Human PDAP1 with an C terminal His tag; 189 amino acids including tag, predicted MWt 21.7kDa.

Specification

• Description: The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity.
• Protein length: 181 amino acids
• Conjugation: HIS
• Molecular Weight: 21.700kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 0.1mM PMSF, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNKLEHHHHHH

Gene Information

• Gene Name: PDAP1 PDGFA associated protein 1 [ Homo sapiens ]
• Official Symbol: PDAP1
• Synonyms: PDAP1; PDGFA associated protein 1; 28 kDa heat- and acid-stable phosphoprotein; HASPP28; PAP; PAP1; PDGF associated protein
• Gene ID: 11333
• mRNA Refseq: NM_014891
• Protein Refseq: NP_055706
• MIM: 607075
• Uniprot ID: Q13442
• Chromosome Location: 7q