Recombinant Human PCYT1A protein, GST-tagged

• Cat.No.: PCYT1A-787H
• Product Overview: Recombinant Human PCYT1A protein(1-76 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 1-76 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP
• Purity: 80%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PCYT1A phosphate cytidylyltransferase 1, choline, alpha [ Homo sapiens ]
• Official Symbol: PCYT1A
• Synonyms: PCYT1A; phosphate cytidylyltransferase 1, choline, alpha; PCYT1, phosphate cytidylyltransferase 1, choline, alpha isoform; choline-phosphate cytidylyltransferase A; CT; CTPCT; phosphate cytidylyltransferase 1; choline; alpha isoform; CT A; CCT A; CCT-alpha; phosphorylcholine transferase A; CTP:phosphocholine cytidylyltransferase A; CTA; CCTA; PCYT1
• mRNA Refseq: NM_005017
• Protein Refseq: NP_005008
• MIM: 123695
• UniProt ID: P49585
• Gene ID: 5130