Recombinant Human PCSK7, GST-tagged
Cat.No. : | PCSK7-134H |
Product Overview : | Human PCSK7 full-length ORF ( AAH06357.1, 1 a.a. - 591 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease. It is structurally related to its family members, PACE and PACE4. This protein is concentrated in the trans-Golgi network, associated with the membranes, and is not secreted. It can process proalbumin and is thought to be responsible for the activation of HIV envelope glycoproteins gp160 and gp140. This gene has been implicated in the transcriptional regulation of housekeeping genes. Multiple alternatively spliced transcripts are described for this gene but their full length nature is not yet known. Downstream of this gene''''s map location at 11q23-q24, nucleotides that match part of this gene''''s 3'''' end are duplicated and inverted. A translocation breakpoint associated with lymphoma occurs between this gene and its inverted counterpart. |
Molecular Mass : | 90.75 kDa |
AA Sequence : | MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGTGGPSWAVHLESLEGDGEEETLEQQAD ALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAVLAGHEAVRWHSEQRLLRRAKRSVHFNDPKY PQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENG NHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRMPFYAEECASMLAVTF SGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALMLQVRPCLTWRDVQHIIVFTATRYEDRRAEWV TNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVPYLASYVSPVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTL EHVAVTVSITHPRRGSLELKLFCPSGMMSLIGAPRSMDSWLCVECSRHQGQTKAVRECHEWKIPAR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PCSK7 proprotein convertase subtilisin/kexin type 7 [ Homo sapiens(human) ] |
Official Symbol | PCSK7 |
Synonyms | PCSK7; LPC; PC7; PC8; SPC7; proprotein convertase subtilisin/kexin type 7; hPC8; prohormone convertase 7; proprotein convertase 7; proprotein convertase 8; prohormone convertase PC7; proprotein convertase PC7; lymphoma proprotein convertase; subtilisin/kexin-like protease PC7; EC 3.4.21.- |
Gene ID | 9159 |
mRNA Refseq | NM_004716 |
Protein Refseq | NP_004707 |
MIM | 604872 |
UniProt ID | Q16549 |
Chromosome Location | 11q23-q24 |
Function | serine-type endopeptidase activity |
◆ Recombinant Proteins | ||
PCSK7-2234C | Recombinant Chicken PCSK7 | +Inquiry |
PCSK7-3970R | Recombinant Rat PCSK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCSK7-135H | Active Recombinant Human PCSK7, His-tagged | +Inquiry |
PCSK7-1583H | Recombinant Human PCSK7, GST-tagged | +Inquiry |
PCSK7-134H | Recombinant Human PCSK7, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK7-3369HCL | Recombinant Human PCSK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCSK7 Products
Required fields are marked with *
My Review for All PCSK7 Products
Required fields are marked with *
0
Inquiry Basket