Recombinant Human PCSK6 protein, hFc-tagged
Cat.No. : | PCSK6-7845H |
Product Overview : | Recombinant Human PCSK6 protein(P29122)(860-969aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 860-969aa |
Tag : | C-hFc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG |
Gene Name | PCSK6 proprotein convertase subtilisin/kexin type 6 [ Homo sapiens ] |
Official Symbol | PCSK6 |
Synonyms | PCSK6; proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4; subtilisin/kexin-like protease PACE4; subtilisin-like proprotein convertase 4; paired basic amino acid cleaving enzyme 4; paired basic amino acid cleaving system 4; PACE4; |
Gene ID | 5046 |
mRNA Refseq | NM_002570 |
Protein Refseq | NP_002561 |
MIM | 167405 |
UniProt ID | P29122 |
◆ Recombinant Proteins | ||
PCSK6-6332H | Recombinant Human PCSK6 protein, His-tagged | +Inquiry |
PCSK6-3303H | Recombinant Human PCSK6 protein, His-tagged | +Inquiry |
PCSK6-3241H | Recombinant Human PCSK6 protein, His-tagged | +Inquiry |
PCSK6-7845H | Recombinant Human PCSK6 protein, hFc-tagged | +Inquiry |
PCSK6-30177TH | Recombinant Human PCSK6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCSK6 Products
Required fields are marked with *
My Review for All PCSK6 Products
Required fields are marked with *
0
Inquiry Basket