Recombinant Human PCP4L1 protein, GST-tagged

• Cat.No.: PCP4L1-3651H
• Product Overview: Recombinant Human PCP4L1 protein(1-68 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-68 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PCP4L1 Purkinje cell protein 4 like 1 [ Homo sapiens (human) ]
• Official Symbol: PCP4L1
• Synonyms: PCP4L1; IQM1; Purkinje cell protein 4 like 1; Purkinje cell protein 4-like protein 1; PCP4-like protein 1
• Gene ID: 654790
• mRNA Refseq: NM_001102566
• Protein Refseq: NP_001096036
• UniProt ID: A6NKN8