Recombinant Human PCNA Protein

• Cat.No.: PCNA-066H
• Product Overview: Recombinant human PCNA protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 261
• Description: The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
• Form: Solution
• Molecular Mass: 28.8 kDa
• AA Sequence: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
• Purity: > 95%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: 4°C
• Concentration: 1 mg/mL
• Storage Buffer: Tris (pH 7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: PCNA proliferating cell nuclear antigen [ Homo sapiens (human) ]
• Official Symbol: PCNA
• Synonyms: PCNA; proliferating cell nuclear antigen; cyclin; DNA polymerase delta auxiliary protein; MGC8367
• Gene ID: 5111
• mRNA Refseq: NM_002592
• Protein Refseq: NP_002583
• MIM: 176740
• UniProt ID: P12004