Recombinant Human PCID2 Protein, GST-tagged

• Cat.No.: PCID2-4235H
• Product Overview: Human FLJ11305 full-length ORF ( AAH16614, 1 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a component of the TREX-2 complex (transcription and export complex 2), which regulates mRNA export from the nucleus. This protein regulates expression of Mad2 mitotic arrest deficient-like 1, a cell division checkpoint protein. This protein also interacts with and stabilizes Brca2 (breast cancer 2) protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
• Molecular Mass: 69.63 kDa
• AA Sequence: MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLLKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYVSHQHQKLVVSKQNPFPPLSTVC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PCID2 PCI domain containing 2 [ Homo sapiens ]
• Official Symbol: PCID2
• Synonyms: PCID2; PCI domain containing 2; PCI domain-containing protein 2; FLJ11305; CSN12-like protein; F10; RP11-98F14.6; FLJ99362; MGC16774; DKFZp686C20226
• Gene ID: 55795
• mRNA Refseq: NM_001127202
• Protein Refseq: NP_001120674
• MIM: 613713
• UniProt ID: Q5JVF3