Recombinant Human PCDHGA2, His-tagged

• Cat.No.: PCDHGA2-30552TH
• Product Overview: Recombinant fragment, corresponding to amino acids 748-932 of Human PCDHGA2 with an N terminal His tag; Predicted MWt 21kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 748-932 a.a.
• Description: This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 63 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AFLQTYSHEVSLTADSRKSHLIFPQPNYADTLISQESCEK KDFLSAPQSLLEEEREETFSQQAPPNTDWRFSQAQRPG TSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGS STLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSN ATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK

Gene Information

• Gene Name: PCDHGA2 protocadherin gamma subfamily A, 2 [ Homo sapiens ]
• Official Symbol: PCDHGA2
• Synonyms: PCDHGA2; protocadherin gamma subfamily A, 2; protocadherin gamma-A2; PCDH GAMMA A2
• Gene ID: 56113
• mRNA Refseq: NM_018915
• Protein Refseq: NP_061738
• MIM: 606289
• Uniprot ID: Q9Y5H1
• Chromosome Location: 5q31
• Function: calcium ion binding