Recombinant Human PCBP2

Cat.No. : PCBP2-29961TH
Product Overview : Recombinant full length Human PCBP2/hnRNP E2 with a N terminal proprietary tag; Predicted MWt 65.93 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 365 amino acids
Description : The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 65.930kDa inclusive of tags
Tissue specificity : Detected in all tissues examined.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMR EESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE EDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVK QICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGS DSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLT KLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDA SAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKI ANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMG SS
Sequence Similarities : Contains 3 KH domains.
Gene Name PCBP2 poly(rC) binding protein 2 [ Homo sapiens ]
Official Symbol PCBP2
Synonyms PCBP2; poly(rC) binding protein 2; poly(rC)-binding protein 2; heterogenous nuclear ribonucleoprotein E2; hnRNP E2; HNRPE2;
Gene ID 5094
mRNA Refseq NM_001098620
Protein Refseq NP_001092090
MIM 601210
Uniprot ID Q15366
Chromosome Location 12q13.12-q13.13
Pathway Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Negative regulators of RIG-I/MDA5 signaling, organism-specific biosystem;
Function DNA binding; RNA binding; RNA binding; enzyme binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PCBP2 Products

Required fields are marked with *

My Review for All PCBP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon