Recombinant Human PCBD1 protein, GST-tagged

• Cat.No.: PCBD1-1804H
• Product Overview: Recombinant Human PCBD1 protein(1-104 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1-104 aa
• AA Sequence: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PCBD1 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [ Homo sapiens ]
• Official Symbol: PCBD1
• Synonyms: PCBD1; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha; 6 pyruvoyl tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) , DCOH, PCBD, pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); pterin-4-alpha-carbinolamine dehydratase; dimerizing cofactor for HNF1; PCD; pterin 4 alpha carbinolamine dehydratase; Pterin 4a carbinolamine dehydratase (dimerization cofactor of hepatic nuclear factor 1 alpha); dimerization cofactor of HNF1; 4-alpha-hydroxy-tetrahydropterin dehydratase; phenylalanine hydroxylase-stimulating protein; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); PHS; DCOH; PCBD
• Gene ID: 5092
• mRNA Refseq: NM_000281
• Protein Refseq: NP_000272
• MIM: 126090
• UniProt ID: P61457