Recombinant Human PBX1 protein, GST-tagged

• Cat.No.: PBX1-2499H
• Product Overview: Recombinant Human PBX1 protein(304-353 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 304-353 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4, 17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: IYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSL

Gene Information

• Gene Name: PBX1 pre-B-cell leukemia homeobox 1 [ Homo sapiens ]
• Official Symbol: PBX1
• Synonyms: PBX1; pre-B-cell leukemia homeobox 1; pre B cell leukemia transcription factor 1; pre-B-cell leukemia transcription factor 1; homeobox protein PRL; homeobox protein PBX1; MGC126627; DKFZp686B09108
• Gene ID: 5087
• mRNA Refseq: NM_001204961
• Protein Refseq: NP_001191890
• MIM: 176310
• UniProt ID: P40424