Recombinant Human PAX6 protein, GST-tagged

• Cat.No.: PAX6-1803H
• Product Overview: Recombinant Human PAX6 protein(126-229 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 126-229 aa
• AA Sequence: VLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEF
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PAX6 paired box 6 [ Homo sapiens ]
• Official Symbol: PAX6
• Synonyms: PAX6; paired box 6; AN2, paired box gene 6 (aniridia, keratitis); paired box protein Pax-6; AN; aniridia; keratitis; D11S812E; WAGR; oculorhombin; aniridia type II protein; paired box homeotic gene-6; AN2; MGDA; MGC17209
• Gene ID: 5080
• mRNA Refseq: NM_000280
• Protein Refseq: NP_000271
• MIM: 607108
• UniProt ID: P26367