Recombinant Human PAX4

• Cat.No.: PAX4-29532TH
• Product Overview: Recombinant fragment corresponding to amino acids 121-217 of Human PAX4 isoform 3 with an N terminal proprietary tag; Predicted MWt 36.3 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 97 amino acids
• Description: This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box 4 gene is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing beta cells.
• Molecular Weight: 36.300kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKW
• Sequence Similarities: Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.Contains 1 paired domain.

Gene Information

• Gene Name: PAX4 paired box 4 [ Homo sapiens ]
• Official Symbol: PAX4
• Synonyms: PAX4; paired box 4; paired box gene 4; paired box protein Pax-4; MODY9
• Gene ID: 5078
• mRNA Refseq: NM_006193
• Protein Refseq: NP_006184
• MIM: 167413
• Uniprot ID: O43316
• Chromosome Location: 7q32.1
• Pathway: Developmental Biology, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in endocrine-committed (NEUROG3+) progenitor cells, organism-specific biosystem
• Function: DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity