Recombinant Human PAX3, GST-tagged

• Cat.No.: PAX3-29056TH
• Product Overview: Recombinant Human PAX3 (1 a.a. - 484 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini.
• Molecular Mass: 79.9 kDa
• AA Sequence: MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQ LRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPS VSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQSDEGSDIDSEPDLPLKRKQRRSRTT FTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGFPPTAMP TLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSG PSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYCP PTYSTTGYSMDPVTGYQYGQYGQSAFHYLKPDIA
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PAX3 paired box 3 [ Homo sapiens (human) ]
• Official Symbol: PAX3
• Synonyms: PAX3; WS1; WS3; CDHS; HUP2; paired box 3; paired box protein Pax-3; paired domain gene 3; paired domain gene HuP2; paired box homeotic gene 3
• Gene ID: 5077
• mRNA Refseq: NM_181458
• Protein Refseq: NP_852123
• MIM: 606597
• UniProt ID: P23760
• Chromosome Location: 2q35
• Pathway: Neural Crest Differentiation; Regulation of retinoblastoma protein; Transcriptional misregulation in cancer
• Function: HMG box domain binding; RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; chromatin binding