Recombinant Human PARP16, GST-tagged

• Cat.No.: PARP16-1129H
• Product Overview: Recombinant Human PARP16 full-length ORF(1 a.a - 323 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: Poly (ADP-ribose) polymerase family, member 16 is a protein in humans that is encoded by the PARP16 gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 62.9 kDa
• AA Sequence: MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSS GDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYETKGERDLIYA FHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKC QTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYL LLLLIVSVINSSAFQHFWNRAKR
• Applications: AP, Array, ELISA, WB-Re
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PARP16 poly (ADP-ribose) polymerase family, member 16 [ Homo sapiens ]
• Official Symbol: PARP16
• Synonyms: ARTD15; pART15; C15orf30; mono [ADP-ribose] polymerase PARP16; ADP-ribosyltransferase diphtheria toxin-like 15; PARP-16; poly [ADP-ribose] polymerase 16; C15orf30, FLJ20509, FLJ25281
• Gene ID: 54956
• mRNA Refseq: NM_017851
• Protein Refseq: NP_060321
• UniProt ID: Q8N5Y8
• Chromosome Location: 15q22.31
• Function: NAD+ ADP-ribosyltransferase activity; kinase binding; protein binding