Recombinant Human PARP14 protein, His&Myc-tagged

• Cat.No.: PARP14-4456H
• Product Overview: Recombinant Human PARP14 protein(Q460N5)(1605-1801aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Yeast.

Specification

• Source: Yeast
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.5 kDa
• Protein length: 1605-1801aa
• AA Sequence: IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PARP14 poly (ADP-ribose) polymerase family, member 14 [ Homo sapiens ]
• Official Symbol: PARP14
• Synonyms: PARP14; poly (ADP-ribose) polymerase family, member 14; poly [ADP-ribose] polymerase 14; KIAA1268; pART8; collaborator of STAT6; B-aggressive lymphoma 2; b aggressive lymphoma protein 2; BAL2; PARP-14
• Gene ID: 54625
• mRNA Refseq: NM_017554
• Protein Refseq: NP_060024
• MIM: 610028
• UniProt ID: Q460N5