Recombinant Human PARP14 protein, His&Myc-tagged

Cat.No. : PARP14-4456H
Product Overview : Recombinant Human PARP14 protein(Q460N5)(1605-1801aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His&Myc
Protein Length : 1605-1801aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.5 kDa
AA Sequence : IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name PARP14 poly (ADP-ribose) polymerase family, member 14 [ Homo sapiens ]
Official Symbol PARP14
Synonyms PARP14; poly (ADP-ribose) polymerase family, member 14; poly [ADP-ribose] polymerase 14; KIAA1268; pART8; collaborator of STAT6; B-aggressive lymphoma 2; b aggressive lymphoma protein 2; BAL2; PARP-14;
Gene ID 54625
mRNA Refseq NM_017554
Protein Refseq NP_060024
MIM 610028
UniProt ID Q460N5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PARP14 Products

Required fields are marked with *

My Review for All PARP14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon