Recombinant Human PARK7

Cat.No. : PARK7-30783TH
Product Overview : Recombinant Full Length Human PARK7/DJ1 expressed in Saccharomyces cerevisiae; amino acids 1-189; 189 amino acids, MWt 19.9 kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-189 a.a.
Description : The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene.
Tissue specificity : Highly expressed in pancreas, kidney, skeletal muscle, liver, testis and heart. Detected at slightly lower levels in placenta and brain. Detected in astrocytes, Sertoli cells, spermatogonia, spermatids and spermatozoa.
Biological activity : This protein contains a proprietary tag (26 kDa) and the whole proteins MW is around 45KD.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAG KDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLG AQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHE IGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSR GPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
Sequence Similarities : Belongs to the peptidase C56 family.
Full Length : Full L.
Gene Name PARK7 parkinson protein 7 [ Homo sapiens ]
Official Symbol PARK7
Synonyms PARK7; parkinson protein 7; Parkinson disease (autosomal recessive, early onset) 7; protein DJ-1; DJ 1; DJ1;
Gene ID 11315
mRNA Refseq NM_001123377
Protein Refseq NP_001116849
MIM 602533
Uniprot ID Q99497
Chromosome Location 1p36.23
Pathway Alpha-synuclein signaling, organism-specific biosystem; Parkinsons disease, organism-specific biosystem;
Function mRNA binding; peptidase activity; peroxidase activity; peroxiredoxin activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PARK7 Products

Required fields are marked with *

My Review for All PARK7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon