Recombinant Human PARG protein, GST-tagged

• Cat.No.: PARG-125H
• Product Overview: Recombinant Human PARG(357 a.a. - 467 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 357-467 a.a.
• Description: Poly(ADP-ribose) glycohydrolase (PARG) is the major enzyme responsible for the catabolism of poly(ADP-ribose), a reversible covalent-modifier of chromosomal proteins. The protein is found in many tissues and may be subject to proteolysis generating smaller, active products. Several transcript variants encoding different isoforms have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.95 kDa
• AA Sequence: YSTKGGEVRLHFQFEGGESRTGMNDLNAKLPGNISSLNVECRNSKQHGKKDSKITDHLMRLPKAEDRRKEQWETK HQRTERKIPKYVPPHLSPDKKWLGTPIEEMRRMPRC
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: >50 ug/mL as determined by microplate BCA method

Gene Information

• Gene Name: PARG poly (ADP-ribose) glycohydrolase [ Homo sapiens ]
• Official Symbol: PARG
• Synonyms: PARG99; poly(ADP-ribose) glycohydrolase; mitochondrial poly(ADP-ribose) glycohydrolase; poly(ADP-ribose) glycohydrolase 60 kDa isoform
• Gene ID: 850
• mRNA Refseq: NM_003631
• Protein Refseq: NP_003622
• MIM: 603501
• UniProt ID: Q86W56
• Chromosome Location: 10q11.23
• Pathway: Base Excision Repair, organism-specific biosystem; DNA Repair, organism-specific biosystem; POLB-Dependent Long Patch Base Excision Repair, organism-specific biosystem
• Function: poly(ADP-ribose) glycohydrolase activity