Recombinant Human PAQR8 Protein, GST-Tagged

• Cat.No.: PAQR8-1324H
• Product Overview: Human PAQR8 full-length ORF (AAH30664, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: PAQR8 (Progestin And AdipoQ Receptor Family Member 8) is a Protein Coding gene. Diseases associated with PAQR8 include Epilepsy With Generalized Tonic-Clonic Seizures and Adolescence-Adult Electroclinical Syndrome. GO annotations related to this gene include steroid hormone receptor activity and steroid binding. An important paralog of this gene is PAQR7.
• Molecular Mass: 64.68 kDa
• AA Sequence: MTTAILERLSTLSVSGQRLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYCYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PAQR8 progestin and adipoQ receptor family member VIII [ Homo sapiens ]
• Official Symbol: PAQR8
• Synonyms: PAQR8; progestin and adipoQ receptor family member VIII; C6orf33, chromosome 6 open reading frame 33; membrane progestin receptor beta; LMPB1; MPRB; mPR beta; lysosomal membrane protein in brain 1; lysosomal membrane protein in brain-1; progestin and adipoQ receptor family member 8; C6orf33; FLJ32521; FLJ46206
• Gene ID: 85315
• mRNA Refseq: NM_133367
• Protein Refseq: NP_588608
• MIM: 607780
• UniProt ID: Q8TEZ7