Recombinant Human PAPSS2, His-tagged

• Cat.No.: PAPSS2-32H
• Product Overview: Recombinant Human Acyl-Protein Thioesterase 1/APT-1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asp230) of Human APT-1 fused with a His tag at the N-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-230 a.a.
• Description: Acyl-Protein Thioesterase 1 (APT-1) is lysophospholipase that belongs to the AB hydrolase 2 family. APT-1 performs on biological membranes to regulate the multifunctional lysophospholipids. It hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS; in addition, it also has depalmitoylating activity and low lysophospholipase activity.
• Form: Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIR SSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPS NRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDP LVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: PAPSS2 3-phosphoadenosine 5-phosphosulfate synthase 2 [ Homo sapiens ]
• Official Symbol: PAPSS2
• Synonyms: PAPSS2; 3-phosphoadenosine 5-phosphosulfate synthase 2; bifunctional 3-phosphoadenosine 5-phosphosulfate synthase 2; ATPSK2; SK 2; PAPSS 2; PAPS synthase 2; PAPS synthetase 2; ATP sulfurylase/APS kinase 2; ATP sulfurylase/adenosine 5-phosphosulfate kinase; 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2; bifunctional 3-phosphoadenosine 5-phosphosulfate synthethase 2; SK2
• Gene ID: 9060
• mRNA Refseq: NM_001015880
• Protein Refseq: NP_001015880
• MIM: 603005
• UniProt ID: O95340
• Chromosome Location: 10q24
• Pathway: Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Formation of PAPS, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem; Purine metabolism, organism-specific biosystem
• Function: ATP binding; adenylylsulfate kinase activity; nucleotide binding; nucleotidyltransferase activity; sulfate adenylyltransferase (ATP) activity