Recombinant Human PANK1 Protein, GST-tagged

Description :	This gene encodes a member of the pantothenate kinase family. Pantothenate kinases are key regulatory enzymes in the biosynthesis of coenzyme A (CoA). The encoded protein catalyzes the first and rate-limiting enzymatic reaction in CoA biosynthesis and is regulated by CoA through feedback inhibition. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. This gene and an intronic miRNA on the same strand are co-regulated by the tumor suppressor p53 (see PMID 20833636).
Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	36.74 kDa
Protein length :	310 a.a. - 409 a.a.
AA Sequence :	IRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYP
Applications :	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Gene Name	PANK1 pantothenate kinase 1 [ Homo sapiens ]
Official Symbol	PANK1
Synonyms	PANK1; pantothenate kinase 1; PANK, pantothenate kinase; MGC24596; PANK1a; PANK1b; pantothenic acid kinase 1; PANK;
Gene ID	53354
mRNA Refseq	NM_148977
Protein Refseq	NP_683878
MIM	606160
UniProt ID	Q8TE04