Recombinant Human PAN3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PAN3-5690H |
Product Overview : | PAN3 MS Standard C13 and N15-labeled recombinant protein (NP_787050) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Myc&DDK |
Description : | PAN3 (Poly(A) Specific Ribonuclease Subunit PAN3) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and Gene Expression. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and poly(A)-specific ribonuclease activity. |
Molecular Mass : | 76 kDa |
AA Sequence : | MDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLMQRMTNSSSSPSLLNDSAKPYSAHDPLTSPASSLFNDFGALNISQRRKTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQHEGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PAN3 poly(A) specific ribonuclease subunit PAN3 [ Homo sapiens (human) ] |
Official Symbol | PAN3 |
Synonyms | PAN3; PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae); PAB-dependent poly(A)-specific ribonuclease subunit 3; PABP-dependent poly(A) nuclease 3; PABP1-dependent poly A-specific ribonuclease subunit PAN3; |
Gene ID | 255967 |
mRNA Refseq | NM_175854 |
Protein Refseq | NP_787050 |
MIM | 617448 |
UniProt ID | Q58A45 |
◆ Recombinant Proteins | ||
UBAC1-0405H | Recombinant Human UBAC1 protein, His-tagged | +Inquiry |
ARF5-5150H | Recombinant Human ARF5 protein, GST-tagged | +Inquiry |
ERBB2-119H | Active Recombinant Human ERBB2 protein, His-tagged | +Inquiry |
Prdx5-2545M | Active Recombinant Mouse Prdx5 protein, His-tagged | +Inquiry |
PDIK1L-3592Z | Recombinant Zebrafish PDIK1L | +Inquiry |
◆ Native Proteins | ||
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
M6PR-398HCL | Recombinant Human M6PR lysate | +Inquiry |
CCDC132-153HCL | Recombinant Human CCDC132 lysate | +Inquiry |
C12orf36-8322HCL | Recombinant Human C12orf36 293 Cell Lysate | +Inquiry |
C1GALT1C1-8191HCL | Recombinant Human C1GALT1C1 293 Cell Lysate | +Inquiry |
KLHL8-945HCL | Recombinant Human KLHL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAN3 Products
Required fields are marked with *
My Review for All PAN3 Products
Required fields are marked with *
0
Inquiry Basket