Recombinant Human PAM

Cat.No. : PAM-30780TH
Product Overview : Recombinant fragment of Human PAM with N terminal proprietary tag; Predicted MW 37.51kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 108 amino acids
Description : This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known.
Molecular Weight : 37.510kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTR LPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMH VFAYRVHTHHLGKVVSGYRVRNGQWTLI
Sequence Similarities : In the C-terminal section; belongs to the peptidyl-alpha-hydroxyglycine alpha-amidating lyase family.In the N-terminal section; belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 5 NHL repeats.
Gene Name PAM peptidylglycine alpha-amidating monooxygenase [ Homo sapiens ]
Official Symbol PAM
Synonyms PAM; peptidylglycine alpha-amidating monooxygenase; peptidyl-glycine alpha-amidating monooxygenase; PAL; peptidyl alpha hydroxyglycine alpha amidating lyase; peptidylglycine alpha hydroxylating monooxygenase; PHM;
Gene ID 5066
mRNA Refseq NM_000919
Protein Refseq NP_000910
MIM 170270
Uniprot ID P19021
Chromosome Location 5q
Function L-ascorbic acid binding; copper ion binding; lyase activity; metal ion binding; peptidylamidoglycolate lyase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PAM Products

Required fields are marked with *

My Review for All PAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon