Recombinant Human PADI2, GST-tagged
Cat.No. : | PADI2-186H |
Product Overview : | Recombinant Human PADI2(1 a.a. - 108 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. |
Molecular Mass : | 37.62 kDa |
AA Sequence : | MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPST TLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQ |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PADI2 peptidyl arginine deiminase, type II [ Homo sapiens (human) ] |
Official Symbol | PADI2 |
Synonyms | PADI2; PAD2; PDI2; PAD-H19; protein-arginine deiminase type-2; protein-arginine deiminase type II; NP_031391.2; EC 3.5.3.15; peptidyl arginine deiminase, type II |
Gene ID | 11240 |
mRNA Refseq | NM_007365 |
Protein Refseq | NP_031391 |
MIM | 607935 |
UniProt ID | Q9Y2J8 |
Chromosome Location | 1p36.13 |
Pathway | protein citrullination |
Function | calcium ion binding; estrogen receptor binding; protein-arginine deiminase activity |
◆ Recombinant Proteins | ||
PADI2-3812HFL | Recombinant Full Length Human PADI2, Flag-tagged | +Inquiry |
Padi2-0147M | Recombinant Mouse Padi2 Protein (Met1-Pro673), C-Strep-tagged | +Inquiry |
PADI2-5628H | Recombinant Human PADI2, MYC/DDK-tagged | +Inquiry |
PADI2-0150H | Recombinant Human PADI2 Protein (Met1-Pro665), N-TwinStrep-tagged | +Inquiry |
Padi2-4652M | Recombinant Mouse Padi2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PADI2 Products
Required fields are marked with *
My Review for All PADI2 Products
Required fields are marked with *
0
Inquiry Basket