Recombinant Human PACSIN1, His-tagged

• Cat.No.: PACSIN1-166H
• Product Overview: Recombinant Human Protein Kinase C and Casein Kinase Substrate in Neurons Protein 1/PACSIN1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ile444) of Human PACSIN1 fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-444 a.a.
• Description: Protein Kinase C and Casein Kinase Substrate in Neurons Protein 1 (PACSIN1) belongs to the PACSIN family. PACSIN1 contains one FCH domain and one SH3 domain. PACSIN1 is highly expressed in the brain and at lower leves in the heart, pancreas, and liver. PACSIN1 may play a role in vesicle formation and transport. PACSIN1 has been shown to interact with DNM1, PACSIN3, Huntingtin, and PACSIN2. In addition, PACSIN1 is phosphorylated by casein kinase 2 (CK2) and protein kinase C (PKC).
• AA Sequence: MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAK RWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFK ETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKV DKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAE NSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEG VALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVRV RALYDYDGQEQDELSFKAGDELTKLGEEDE QGWCRGRLDSGQLGLYPANYVEAIVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: PACSIN1 protein kinase C and casein kinase substrate in neurons 1 [ Homo sapiens ]
• Official Symbol: PACSIN1
• Synonyms: PACSIN1; protein kinase C and casein kinase substrate in neurons 1; protein kinase C and casein kinase substrate in neurons protein 1; SDPI; syndapin I; KIAA1379
• Gene ID: 29993
• mRNA Refseq: NM_001199583
• Protein Refseq: NP_001186512
• MIM: 606512
• UniProt ID: Q9BY11
• Chromosome Location: 6p21.3
• Function: cytoskeletal protein binding; protein kinase activity