Recombinant Human P2RX4 protein, GST-tagged

• Cat.No.: P2RX4-301584H
• Product Overview: Recombinant Human P2RX4 (57-341 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Thr57-Ser341
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: TDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHGFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: P2RX4 purinergic receptor P2X, ligand-gated ion channel, 4 [ Homo sapiens ]
• Official Symbol: P2RX4
• Synonyms: P2RX4; purinergic receptor P2X, ligand-gated ion channel, 4; P2X purinoceptor 4; P2X4; ATP receptor; purinoceptor P2X4; P2X receptor, subunit 4; purinergic receptor P2X4; ATP-gated cation channel protein; P2X4R
• Gene ID: 5025
• mRNA Refseq: NM_001256796
• Protein Refseq: NP_001243725
• MIM: 600846
• UniProt ID: Q99571