Recombinant Human P2RX4 protein, GST-tagged

Cat.No. : P2RX4-301584H
Product Overview : Recombinant Human P2RX4 (57-341 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Thr57-Ser341
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
AA Sequence : TDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHGFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name P2RX4 purinergic receptor P2X, ligand-gated ion channel, 4 [ Homo sapiens ]
Official Symbol P2RX4
Synonyms P2RX4; purinergic receptor P2X, ligand-gated ion channel, 4; P2X purinoceptor 4; P2X4; ATP receptor; purinoceptor P2X4; P2X receptor, subunit 4; purinergic receptor P2X4; ATP-gated cation channel protein; P2X4R;
Gene ID 5025
mRNA Refseq NM_001256796
Protein Refseq NP_001243725
MIM 600846
UniProt ID Q99571

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All P2RX4 Products

Required fields are marked with *

My Review for All P2RX4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon