Recombinant Human OXLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: OXLD1-2639H
• Product Overview: C17orf90 MS Standard C13 and N15-labeled recombinant protein (NP_001034931) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: OXLD1 (Oxidoreductase Like Domain Containing 1) is a Protein Coding gene. Diseases associated with OXLD1 include Mixed Receptive-Expressive Language Disorder and Baraitser-Winter Syndrome.
• Molecular Mass: 15.9 kDa
• AA Sequence: MLLRRVVEGGRAVAAAVRGSGARRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPPELQPPTNCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHTRCGGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: OXLD1 oxidoreductase like domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: OXLD1
• Synonyms: OXLD1; oxidoreductase like domain containing 1; C17orf90; oxidoreductase-like domain-containing protein 1
• Gene ID: 339229
• mRNA Refseq: NM_001039842
• Protein Refseq: NP_001034931
• UniProt ID: Q5BKU9