Recombinant Human OXLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OXLD1-2639H
Product Overview : C17orf90 MS Standard C13 and N15-labeled recombinant protein (NP_001034931) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Myc&DDK
Description : OXLD1 (Oxidoreductase Like Domain Containing 1) is a Protein Coding gene. Diseases associated with OXLD1 include Mixed Receptive-Expressive Language Disorder and Baraitser-Winter Syndrome.
Molecular Mass : 15.9 kDa
AA Sequence : MLLRRVVEGGRAVAAAVRGSGARRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPPELQPPTNCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHTRCGGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OXLD1 oxidoreductase like domain containing 1 [ Homo sapiens (human) ]
Official Symbol OXLD1
Synonyms OXLD1; oxidoreductase like domain containing 1; C17orf90; oxidoreductase-like domain-containing protein 1
Gene ID 339229
mRNA Refseq NM_001039842
Protein Refseq NP_001034931
UniProt ID Q5BKU9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All OXLD1 Products

Required fields are marked with *

My Review for All OXLD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon