Recombinant Human OTX2 protein, T7/His-tagged

• Cat.No.: OTX2-193H
• Product Overview: Recombinant human OTX2 (2 - 297 aa, Isoform-I, derived from BC032579) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 2-297 a.a.
• Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEFMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRR ERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKT SPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYA GSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTAS WKLNFNADCLDYKDQTSSWKFQVL
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: OTX2 orthodenticle homeobox 2 [ Homo sapiens ]
• Official Symbol: OTX2
• Synonyms: OTX2; orthodenticle homeobox 2; orthodenticle homolog 2 (Drosophila); homeobox protein OTX2; orthodenticle homolog 2; CPHD6; MCOPS5; MGC45000
• Gene ID: 5015
• mRNA Refseq: NM_021728
• Protein Refseq: NP_068374
• MIM: 600037
• UniProt ID: P32243
• Chromosome Location: 14q22.3
• Function: RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; eukaryotic initiation factor 4E binding; protein binding; sequence-specific DNA binding; sequence