Recombinant Human OTUB2, His-tagged
Cat.No. : | OTUB2-30525TH |
Product Overview : | Recombinant full length protein, (amino acids 1-234) of Human OTUB2 with N terminal His tag; 254 amino acids, 29.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 234 amino acids |
Description : | This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. |
Conjugation : | HIS |
Molecular Weight : | 29.400kDa inclusive of tags |
Tissue specificity : | Widely expressed. Expressed at higher level in brain. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.29% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSETSFNLISEKCDILSILR DHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSY LESLLGKSREIFKFKERVLQTPNDLLAAGFEEHKFRNFFN AFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQI TALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLY KTSHYNILYAADKH |
Sequence Similarities : | Belongs to the peptidase C65 family.Contains 1 OTU domain. |
Gene Name | OTUB2 OTU domain, ubiquitin aldehyde binding 2 [ Homo sapiens ] |
Official Symbol | OTUB2 |
Synonyms | OTUB2; OTU domain, ubiquitin aldehyde binding 2; C14orf137, chromosome 14 open reading frame 137; ubiquitin thioesterase OTUB2; FLJ21916; MGC3102; |
Gene ID | 78990 |
mRNA Refseq | NM_023112 |
Protein Refseq | NP_075601 |
MIM | 608338 |
Uniprot ID | Q96DC9 |
Chromosome Location | 14q32.13-q32.2 |
Function | cysteine-type peptidase activity; omega peptidase activity; peptidase activity; ubiquitin-specific protease activity; ubiquitin-specific protease activity; |
◆ Recombinant Proteins | ||
OTUB2-5173H | Recombinant Human OTUB2 Protein (Met1-His234), N-Gst tagged | +Inquiry |
OTUB2-2534H | Recombinant Human OTUB2 protein, His-tagged | +Inquiry |
OTUB2-354H | Recombinant Human OTUB2 Protein, GST-tagged | +Inquiry |
OTUB2-4847H | Recombinant Human OTUB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OTUB2-353H | Recombinant Human OTUB2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTUB2-3515HCL | Recombinant Human OTUB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OTUB2 Products
Required fields are marked with *
My Review for All OTUB2 Products
Required fields are marked with *
0
Inquiry Basket