Recombinant Human OSTC Protein, GST-tagged

• Cat.No.: OSTC-26H
• Product Overview: Recombinant Human OSTC(1 a.a. - 149 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 149 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.2 kDa
• AA Sequence: METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG
• Applications: Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: OSTC oligosaccharyltransferase complex subunit [ Homo sapiens ]
• Official Symbol: OSTC
• Synonyms: OSTC; oligosaccharyltransferase complex subunit; oligosaccharyltransferase complex subunit OSTC; DC2; DC2 protein; hydrophobic protein HSF-28
• Gene ID: 58505
• mRNA Refseq: NM_021227
• Protein Refseq: NP_067050
• UniProt ID: Q9NRP0