Recombinant Human ORMDL2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ORMDL2-1375H
• Product Overview: ORMDL2 MS Standard C13 and N15-labeled recombinant protein (NP_054901) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ORMDL2 (ORMDL Sphingolipid Biosynthesis Regulator 2) is a Protein Coding gene. Diseases associated with ORMDL2 include Retinitis Pigmentosa 26 and Aggressive Systemic Mastocytosis. Among its related pathways are Sphingolipid metabolism and Metabolism. An important paralog of this gene is ORMDL1.
• Molecular Mass: 17.4 kDa
• AA Sequence: MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLATYVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSVLLPKLPQFHGVRVFGINKYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ORMDL2 ORMDL sphingolipid biosynthesis regulator 2 [ Homo sapiens (human) ]
• Official Symbol: ORMDL2
• Synonyms: ORMDL2; ORM1-like 2 (S. cerevisiae); ORM1 (S. cerevisiae) like 2; ORM1-like protein 2; adoplin 2; HSPC160; MST095; MSTP095; expressed in normal aorta; adoplin-2
• Gene ID: 29095
• mRNA Refseq: NM_014182
• Protein Refseq: NP_054901
• MIM: 610074
• UniProt ID: Q53FV1