Recombinant Full Length Human Orm1-Like Protein 2(Ormdl2) Protein, His-Tagged
Cat.No. : | RFL31412HF |
Product Overview : | Recombinant Full Length Human ORM1-like protein 2(ORMDL2) Protein (Q53FV1) (1-153aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-153) |
Form : | Lyophilized powder |
AA Sequence : | MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLAT YVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD AAHFLINTASLLSVLLPKLPQFHGVRVFGINKY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORMDL2 |
Synonyms | ORMDL2; HSPC160; MSTP095; ORM1-like protein 2; Adoplin-2 |
UniProt ID | Q53FV1 |
◆ Recombinant Proteins | ||
RFL13981MF | Recombinant Full Length Mouse Orm1-Like Protein 2(Ormdl2) Protein, His-Tagged | +Inquiry |
Ormdl2-4603M | Recombinant Mouse Ormdl2 Protein, Myc/DDK-tagged | +Inquiry |
ORMDL2-2979C | Recombinant Chicken ORMDL2 | +Inquiry |
ORMDL2-1375H | Recombinant Human ORMDL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL28056BF | Recombinant Full Length Bovine Orm1-Like Protein 2(Ormdl2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ORMDL2-3547HCL | Recombinant Human ORMDL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORMDL2 Products
Required fields are marked with *
My Review for All ORMDL2 Products
Required fields are marked with *
0
Inquiry Basket