Recombinant Human OR7D4 protein, His-KSI-tagged

• Cat.No.: OR7D4-6363H
• Product Overview: Recombinant Human OR7D4 protein(Q8NG98)(161-197aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&KSI
• Protein Length: 161-197a.a.
• Tag: His-KSI
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.5 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LLMKRLTFSTGTEIPHFFCEPAQVLKVACSNTLLNNI

Gene Information

• Gene Name: OR7D4 olfactory receptor, family 7, subfamily D, member 4 [ Homo sapiens ]
• Official Symbol: OR7D4
• Synonyms: OR7D4; olfactory receptor, family 7, subfamily D, member 4; OR7D4P; olfactory receptor 7D4; hg105; OR19 B; olfactory receptor OR19-7; odorant receptor family 7 subfamily D member 4 RT; olfactory receptor, family 7, subfamily D, member 4 pseudogene; OR19B; OR19-7; OR19-B
• Gene ID: 125958
• mRNA Refseq: NM_001005191
• Protein Refseq: NP_001005191
• MIM: 611538
• UniProt ID: Q8NG98