Recombinant Human OR2H1 protein, GST-tagged

• Cat.No.: OR2H1-7877H
• Product Overview: Recombinant Human OR2H1 protein(128-170 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 128-170 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ
• Purity: 90%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: OR2H1 olfactory receptor, family 2, subfamily H, member 1 [ Homo sapiens ]
• Official Symbol: OR2H1
• Synonyms: OR2H1; olfactory receptor, family 2, subfamily H, member 1; olfactory receptor, family 2, subfamily H, member 8 , OR2H6, OR2H8; olfactory receptor 2H1; OR6 2; OLFR42A-9004.14/9026.2; olfactory receptor 2H6; olfactory receptor 2H8; olfactory receptor 6-2; olfactory receptor OR6-32; olfactory receptor, family 2, subfamily H, member 6; olfactory receptor, family 2, subfamily H, member 8; OR2H6; OR2H8; OR6-2; 6M1-16; HS6M1-16; dJ994E9.4; OLFR42A-9004-14
• mRNA Refseq: NM_030883
• Protein Refseq: NP_112145
• UniProt ID: Q9GZK4
• Gene ID: 26716