Recombinant Human OR1A1 Full Length Transmembrane protein (1-309 aa), His-SUMO-tagged
Cat.No. : | OR1A1-2719H |
Product Overview : | Recombinant Human OR1A1 Protein (1-309 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-309aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.6kDa |
AA Sequence : | MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | OR1A1 olfactory receptor, family 1, subfamily A, member 1 [ Homo sapiens ] |
Official Symbol | OR1A1 |
Synonyms | OR1A1; olfactory receptor, family 1, subfamily A, member 1; olfactory receptor 1A1; OR17 7; olfactory receptor 17-7; olfactory receptor OR17-11; OR17-7; |
Gene ID | 8383 |
mRNA Refseq | NM_014565 |
Protein Refseq | NP_055380 |
UniProt ID | Q9P1Q5 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR1A1 Products
Required fields are marked with *
My Review for All OR1A1 Products
Required fields are marked with *
0
Inquiry Basket