Recombinant Human OMD protein, GST-tagged
Cat.No. : | OMD-7866H |
Product Overview : | Recombinant Human OMD protein(200-421 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 200-421 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQE |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | OMD osteomodulin [ Homo sapiens ] |
Official Symbol | OMD |
Synonyms | OMD; osteomodulin; osteoadherin; osteoadherin proteoglycan; SLRR2C; KSPG osteomodulin; keratan sulfate proteoglycan osteomodulin; OSAD; |
mRNA Refseq | NM_005014 |
Protein Refseq | NP_005005 |
UniProt ID | Q99983 |
Gene ID | 4958 |
◆ Recombinant Proteins | ||
OMD-3846R | Recombinant Rat OMD Protein, His (Fc)-Avi-tagged | +Inquiry |
OMD-3100H | Recombinant Human OMD protein, His-tagged | +Inquiry |
OMD-251H | Recombinant Human OMD Protein, His-tagged | +Inquiry |
OMD-7866H | Recombinant Human OMD protein, GST-tagged | +Inquiry |
Omd-3298M | Recombinant Mouse Osteomodulin, His-tagged | +Inquiry |
◆ Native Proteins | ||
OMD-137C | Native Chicken Ovomucoid | +Inquiry |
◆ Cell & Tissue Lysates | ||
OMD-2385MCL | Recombinant Mouse OMD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OMD Products
Required fields are marked with *
My Review for All OMD Products
Required fields are marked with *
0
Inquiry Basket