Recombinant Human OLR1 Protein, His-tagged

• Cat.No.: OLR1-01H
• Product Overview: Recombinant human OLR1 (58-273aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect cells
• Tag: His
• Protein Length: 58-273 a.a.
• Description: This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.
• Form: Liquid
• Molecular Mass: 25.8 kDa (225aa)
• AA Sequence: ADPMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQHHHHHH
• Endotoxin: < 1.0 EU/μg of the protein by the LAL method.
• Purity: > 95% as analyzed by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: OLR1 oxidized low density lipoprotein receptor 1 [ Homo sapiens (human) ]
• Official Symbol: OLR1
• Synonyms: OLR1; oxidized low density lipoprotein receptor 1; LOX1; LOXIN; SLOX1; CLEC8A; SCARE1; oxidized low-density lipoprotein receptor 1; C-type lectin domain family 8 member A; hLOX-1; lectin-type oxidized LDL receptor 1; ox LDL receptor 1; oxidized low density lipoprotein (lectin-like) receptor 1; oxidized low-density lipoprotein receptor 1, soluble form; scavenger receptor class E, member 1
• Gene ID: 4973
• mRNA Refseq: NM_002543
• Protein Refseq: NP_002534
• MIM: 602601
• UniProt ID: P78380