Recombinant Human OLAH Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OLAH-5297H
Product Overview : OLAH MS Standard C13 and N15-labeled recombinant protein (NP_001034791) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : OLAH (Oleoyl-ACP Hydrolase) is a Protein Coding gene. Diseases associated with OLAH include Rheumatoid Arthritis and Arthritis. Among its related pathways are Fatty acid biosynthesis (KEGG) and Metabolism. Gene Ontology (GO) annotations related to this gene include hydrolase activity, acting on ester bonds and myristoyl-[acyl-carrier-protein] hydrolase activity.
Molecular Mass : 29.9 kDa
AA Sequence : MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OLAH oleoyl-ACP hydrolase [ Homo sapiens (human) ]
Official Symbol OLAH
Synonyms OLAH; oleoyl-ACP hydrolase; THEDC1, thioesterase domain containing 1; S-acyl fatty acid synthase thioesterase, medium chain; FLJ11106; SAST; thioesterase II; thioesterase domain containing 1; augmented in rheumatoid arthritis 1; thioesterase domain-containing protein 1; AURA1; THEDC1; MGC51852;
Gene ID 55301
mRNA Refseq NM_001039702
Protein Refseq NP_001034791
UniProt ID Q9NV23

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All OLAH Products

Required fields are marked with *

My Review for All OLAH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon